PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00027.46
Common NameAMTR_s00027p00144540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 198aa    MW: 22530.2 Da    PI: 6.8884
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00027.46genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.61.2e-191671156
                                             TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                 Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                             rr++ +f++eq++ Le++Fek+  + a+++ eLA++lgL+ rq+ +WFqNrRa++k
  evm_27.model.AmTr_v1.0_scaffold00027.46 16 RREKKRFSQEQVRSLESAFEKEGRLEAKRKGELARELGLNPRQIAIWFQNRRARWK 71
                                             789999*************************************************9 PP

2HD-ZIP_I/II114.66.1e-3718109293
                              HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkrayd 71 
                                               k+r+s+eqv++LE+ Fe+e +Le +rK elareLgl+prq+a+WFqnrRAR+k+kqlE+dy +L + y+
  evm_27.model.AmTr_v1.0_scaffold00027.46  18 EKKRFSQEQVRSLESAFEKEGRLEAKRKGELARELGLNPRQIAIWFQNRRARWKSKQLERDYGVLGADYQ 87 
                                              79******************************************************************** PP

                              HD-ZIP_I/II  72 alkeenerLekeveeLreelke 93 
                                              al ++ ++L++e+++L ++l++
  evm_27.model.AmTr_v1.0_scaffold00027.46  88 ALLSSFQSLKQEKRTLIKQLQK 109
                                              *******************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.27E-20975IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-21972IPR009057Homeodomain-like
PROSITE profilePS5007119.0951373IPR001356Homeobox domain
SMARTSM003895.7E-181577IPR001356Homeobox domain
PfamPF000465.6E-171671IPR001356Homeobox domain
CDDcd000861.54E-152274No hitNo description
PRINTSPR000311.4E-64453IPR000047Helix-turn-helix motif
PROSITE patternPS0002704871IPR017970Homeobox, conserved site
PRINTSPR000311.4E-65369IPR000047Helix-turn-helix motif
PfamPF021834.0E-1573114IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MEGGEMGGGE RKRGKRREKK RFSQEQVRSL ESAFEKEGRL EAKRKGELAR ELGLNPRQIA  60
IWFQNRRARW KSKQLERDYG VLGADYQALL SSFQSLKQEK RTLIKQLQKL GAVLEKSEAS  120
GSAEGDDTVK DATAYSDGEY SREVNGSKLV YDEPEMLYEA EEVLMGSFSP TIKTSPSDSG  180
WFCDQPFTSS QWWELWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11119KRGKRREKK
26573RRARWKSKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00650PBMTransfer from LOC_Os09g35910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006849161.21e-129PREDICTED: homeobox-leucine zipper protein HOX6
SwissprotQ651Z53e-38HOX6_ORYSJ; Homeobox-leucine zipper protein HOX6
SwissprotQ9XH353e-38HOX6_ORYSI; Homeobox-leucine zipper protein HOX6
TrEMBLW1PL751e-141W1PL75_AMBTC; Uncharacterized protein
STRINGVIT_16s0098g01170.t013e-41(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.11e-34homeobox 7
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]